1/16
Latest Priya Prakash Varrier W screenshot 0
Latest Priya Prakash Varrier W screenshot 1
Latest Priya Prakash Varrier W screenshot 2
Latest Priya Prakash Varrier W screenshot 3
Latest Priya Prakash Varrier W screenshot 4
Latest Priya Prakash Varrier W screenshot 5
Latest Priya Prakash Varrier W screenshot 6
Latest Priya Prakash Varrier W screenshot 7
Latest Priya Prakash Varrier W screenshot 8
Latest Priya Prakash Varrier W screenshot 9
Latest Priya Prakash Varrier W screenshot 10
Latest Priya Prakash Varrier W screenshot 11
Latest Priya Prakash Varrier W screenshot 12
Latest Priya Prakash Varrier W screenshot 13
Latest Priya Prakash Varrier W screenshot 14
Latest Priya Prakash Varrier W screenshot 15
Latest Priya Prakash Varrier W Icon

Latest Priya Prakash Varrier W

UnivStudios Entertainment Apps
Trustable Ranking IconTrusted
1K+Downloads
11MBSize
Android Version Icon4.0.3 - 4.0.4+
Android Version
1.2(19-10-2020)Latest version
-
(0 Reviews)
Age ratingPEGI-3
Download
DetailsReviewsVersionsInfo
1/16

Description of Latest Priya Prakash Varrier W

Priya Prakash Varrier Wallpapers HD app is to not only setting Priya Prakash Varrier photos as wallpapers but also share & save selected favorite image.


Priya Prakash Varrier got her fame from Oru Adaar Love, Lovers Day..etc Telugu & Malayalam movies in Tollywood and Mollywood. Priya Prakash Varrier is an overnight social media sensation with wink girl video. She famous as cute wynk school girl in social media.


You can express your love towards Priya Prakash Varrier with others by sharing these Priya Prakash Varrier wallpapers HD!


Priya Prakash Varrier Wallpapers HD , We all love Priya Prakash Varrier ! Welcome to the world of beauty Priya Prakash Varrier. Here you can find some very hot and sexy Priya Prakash Varrier wallpaper for your phones and tablets.


You can save your favorite Priya Prakash Varrier Babe image onto your mobile device and set them as lock screens and wallpapers.


Features of Priya Prakash Varrier Wallpapers HD App:


1.You can set the beautiful Priya Prakash Varrier image as wallpaper.


2. You can save your liked Priya Prakash Varrier wallpaper to your gallery.


3. You can add Priya Prakash Varrier wallpaper to your favorites and can go through the selected wallpapers easily from your favorites than searching in the entire gallery., so it can save your time.


4. You can share your favorite Priya Prakash Varrier wallpaper with your friends through watsapp, hike,share it, bluetooth, facebook..etc


5. You can zoom Priya Prakash Varrier image.


There are lots of background pictures of pretty Priya Prakash Varrier .

This application is made for only one purpose and it is fun or entertainment.


With Priya Prakash Varrier Wallpapers HD, Make your phone looks attractive by setting HD Images of Hot & Sexy Priya Prakash Varrier. Amazing Lovely Background, you can choose any photo and set as your home screen in a click away.


Disclaimer

The content provided in this app is available in public domain & Web. We do not upload any images or not showing any modified content. If any image wants to be removed from the App or if any images we linked is unauthorized or violating copyrights., Please send mail to univstudiosapps@gmail.com with specific image and We will Remove the image ASAP. Please email us if any images we linked is unauthorized or violating copyrights.


contact email : univstudiosapps@gmail.com

Latest Priya Prakash Varrier W - Version 1.2

(19-10-2020)
Other versions

There are no reviews or ratings yet! To leave the first one please

-
0 Reviews
5
4
3
2
1

Latest Priya Prakash Varrier W - APK Information

APK Version: 1.2Package: com.univstudiosapps.priyaprakashvarrierwallpapershd
Android compatability: 4.0.3 - 4.0.4+ (Ice Cream Sandwich)
Developer:UnivStudios Entertainment AppsPrivacy Policy:http://univstudiosentertainmentapps.blogspot.com/2018/10/univstudios-entertainment-apps-privacy.htmlPermissions:5
Name: Latest Priya Prakash Varrier WSize: 11 MBDownloads: 0Version : 1.2Release Date: 2021-04-25 22:05:29Min Screen: SMALLSupported CPU:
Package ID: com.univstudiosapps.priyaprakashvarrierwallpapershdSHA1 Signature: E6:A7:E8:2D:4E:B4:1D:D8:E3:72:40:16:98:89:4D:30:7A:56:C4:6ADeveloper (CN): AndroidOrganization (O): Google Inc.Local (L): Mountain ViewCountry (C): USState/City (ST): CaliforniaPackage ID: com.univstudiosapps.priyaprakashvarrierwallpapershdSHA1 Signature: E6:A7:E8:2D:4E:B4:1D:D8:E3:72:40:16:98:89:4D:30:7A:56:C4:6ADeveloper (CN): AndroidOrganization (O): Google Inc.Local (L): Mountain ViewCountry (C): USState/City (ST): California

Latest Version of Latest Priya Prakash Varrier W

1.2Trust Icon Versions
19/10/2020
0 downloads11 MB Size
Download